PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000934638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 297aa    MW: 33495.3 Da    PI: 6.5126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000934638genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll+++++ +G g+W+  a+  g++Rt+k+c++rw++yl
    MDP0000934638 15 KGPWTLEEDNLLIHYIANHGEGHWNYLAKFAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding52.71e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    MDP0000934638  68 RGNLTPQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4291062IPR017930Myb domain
SuperFamilySSF466896.53E-3113109IPR009057Homeodomain-like
SMARTSM007171.0E-131464IPR001005SANT/Myb domain
PfamPF002498.9E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-231669IPR009057Homeodomain-like
CDDcd001671.39E-111762No hitNo description
PROSITE profilePS5129425.75163117IPR017930Myb domain
SMARTSM007172.7E-1567115IPR001005SANT/Myb domain
PfamPF002491.0E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370116IPR009057Homeodomain-like
CDDcd001671.49E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MAAPRNPNEE NELRKGPWTL EEDNLLIHYI ANHGEGHWNY LAKFAGLKRT GKSCRLRWLN  60
YLKPDIKRGN LTPQEQLLIL ELHSKWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKQARQL  120
NIESNSVQFL DAVRGFWMPI LLQKMKQSSR SSTLSPSQNS ASPSLSPNHT VPSVPLPTSP  180
PGNVTNMFDN YHMSGNSNLA TVPSNILSSE SLISQVPQMA EQSTSLYPAF DHIGYXSLSP  240
DGSYYVDNSS YDMEGLSLDP VSAMGNYDNS QFDCQMVGND WVLDTITDNL WNMDGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25121174108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159970.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744620.0DQ074462.1 Malus x domestica MYB7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389270.10.0PREDICTED: myb-related protein 305
SwissprotQ9LK957e-65MYB21_ARATH; Transcription factor MYB21
TrEMBLQ2LMF01e-177Q2LMF0_MALDO; MYB7
STRINGPOPTR_0008s12130.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.14e-83myb domain protein 62